D-me
Domain names and websites. Hosting, ip, geo and other data

happyclicky.com


Domain is on IP Number: 2400:cb00:2048:1::681b:9a55 Server content last refreshed: 2016-08-14

Traffic Volume   Backlinks

Current location of Happyclicky.com host was found to be: Columbus, United States. Lower down this page is a map and more details of Happyclicky.com location. We think our information is right, but if you think otherwise then send us a message about it.



  Website Speed

Happyclicky.com html load speed of the main page is 0.41 seconds. This is a good result, but there might be things that you want to improve or fix. Scroll down for the list of urls of useful tools to monitor an analyze Happyclicky.com.

  Happyclicky.com Location

Country of Origin: United States
Metropolitan Zone: Columbus
Post or Zip Code: 28722
Latitude: 35.2532
Longitude: -82.1971


 More Additional Tools and Services For Happyclicky.com


Alexa
  • Traffic
  • Pageviews
  • Bounce %
  • Search %
img
img
img
img
Other Domains Hosted on the 2400:cb00:2048:1::681b:9a55 IP
We could not trace any IP address for this domain

Did you register happyclicky.com and do you want your details removed from this website? If so, please do not wait to get in touch.

SIMILAR

happyclickz.comhappyclicque.comhappyclient.reviewshappyclicktowinforlife.comhappyclickstore.comhappyclicksphotography.comhncw9m.com