D-me
Domain names and websites. Hosting, ip, geo and other data

weeklygig.com


Domain is on IP Number: 185.102.136.139 Server content last refreshed: 2018-06-03

Traffic Volume   Backlinks

Current location of Weeklygig.com host was found to be: Moscow, Russia. Lower down this page is a map and more details of Weeklygig.com location. We think our information is right, but if you think otherwise then send us a message about it.



  Weeklygig.com Main Page Headings

Title: HugeDomains.com - WeeklyGig.com is for sale (Weekly Gig)
H1: WeeklyGig.com is for sale

  Website Speed

It took 7.78 seconds to load the html of the main page from the location of our server. We are sure that this is not a good rate for a website. There are different ways to improve the speed if Weeklygig.com. In order to check for issues try to use the tools that are listed in the bottom of the current web page.

  Weeklygig.com Location

Country of Origin: Russia
Metropolitan Zone: Moscow
Post or Zip Code: 101752
Latitude: 55.7522
Longitude: 37.6156


 More Additional Tools and Services For Weeklygig.com


Alexa
  • Traffic
  • Pageviews
  • Bounce %
  • Search %
img
img
img
img
Other Domains Hosted on the 185.102.136.139 IP

Did you register weeklygig.com and do you want your details removed from this website? If so, please do not wait to get in touch.

SIMILAR

weeklygigs.comweeklygist.netweeklygiveaway.netweeklygiftz.comweeklygiftz.comweeklygiftideas.comw2h5py.com